General Information

  • ID:  hor006974
  • Uniprot ID:  P21246??34-168)
  • Protein name:  Pleiotrophin
  • Gene name:  GH1
  • Organism:  Homo sapiens
  • Family:  Pleiotrophin family
  • Source:  Animal
  • Expression:  Osteoblast and brain.
  • Disease:  NA
  • Comments:  NA
  • Taxonomy:  Eukaryota; Opisthokonta; Metazoa; Eumetazoa; Bilateria; Deuterostomia; Chordata; Craniata; Vertebrata; Gnathostomata (jawed vertebrates); Teleostomi; Euteleostomi; Sarcopterygii; Dipnotetrapodomorpha; Tetrapoda; Amniota; Mammalia; Theria; Eutheria; Boreoeutheria; Euarchontoglires; Primates; Haplorrhini; Simiiformes; Catarrhini; Hominoidea (apes); Hominidae (great apes); Homininae; Homo; Homo sapiens (Human)
  • GO MF:  GO:0005783 endoplasmic reticulum; GO:0005576 extracellular region; GO:0005615 extracellular space; GO:0005886 plasma membrane; GO:0032991 protein-containing complex; GO:0098685 Schaffer collateral - CA1 synapse
  • GO BP:  GO:0008201 heparin binding; GO:0004864 protein phosphatase inhibitor activity; GO:0005178 integrin binding; GO:0008083 growth factor activity; GO:0035374 chondroitin sulfate binding; GO:0019901 protein kinase binding; GO:0140677 molecular function activator activity; GO:0030246 carbohydrate binding
  • GO CC:  GO:0043932 ossification involved in bone remodeling; GO:0048714 positive regulation of oligodendrocyte differentiation; GO:0010976 positive regulation of neuron projection development; GO:0002690 positive regulation of leukocyte chemotaxis; GO:2000347 positive regulation of hepatocyte proliferation; GO:1900006 positive regulation of dendrite development; GO:0008284 positive regulation of cell population proliferation; GO:0051781 positive regulation of cell division; GO:0002232 leukocyte chemotaxis involved in inflammatory response; GO:0007613 memory; GO:1900272 negative regulation of long-term synaptic potentiation; GO:0007406 negative regulation of neuroblast proliferation; GO:0007399 nervous system development; GO:0048477 oogenesis; GO:0048680 positive regulation of axon regeneration; GO:0030501 positive regulation of bone mineralization; GO:0010594 regulation of endothelial cell migration; GO:0007612 learning; GO:0043113 receptor clustering; GO:0031641 regulation of myelination; GO:

Sequence Information

  • Sequence:  KKEKPEKKVKKSDCGEWQWSVCVPTSGDCGLGTREGTRTGAECKQTMKTQRCKIPCNWKKQFGAECKYQFQAWGECDLNTALKTRTGSLKRALHNAECQKTVTISKPCGKLTKPKPQAESKKKKKEGKKQEKMLD
  • Length:  135
  • Propeptide:  MQAQQYQQQRRKFAAAFLAFIFILAAVDTAEAGKKEKPEKKVKKSDCGEWQWSVCVPTSGDCGLGTREGTRTGAECKQTMKTQRCKIPCNWKKQFGAECKYQFQAWGECDLNTALKTRTGSLKRALHNAECQKTVTISKPCGKLTKPKPQAESKKKKKEGKKQEKMLD
  • Signal peptide:  MQAQQYQQQRRKFAAAFLAFIFILAAVDTAEA
  • Modification:  NA
  • Glycosylation:  NA
  • Mutagenesis:  NA

Activity

  • Function:  NA
  • Mechanism:  NA
  • Cross BBB:  NA
  • Target:  NA
  • Target Unid:  NA
  • IC50: NA
  • EC50: NA
  • ED50: NA
  • kd: NA
  • Half life: NA

Structure

  • Disulfide bond:  NA
  • Structure ID:  NA

  • Structure: (PDB_ID-from https://www.rcsb.org/; AlphaFold_DB_ID-from https://alphafold.ebi.ac.uk/; hordbxxxxxx_AF2.pdb was predicted structure by AlphaFold2; hordbxxxxxx_ESM.pdb was predicted structure by ESMFold)
    •    NA

Physical Information

Mass: Formula:
Absent amino acids: Common amino acids:
pI: Basic residues:
Polar residues: Hydrophobic residues:
Hydrophobicity: Boman Index:
Half-Life: Half-Life Yeast:
Half-Life E.Coli: Aliphatic Index
Instability Index: Extinction Coefficient cystines:
Absorbance 280nm:

Literature

  • PubMed ID:  NA
  • Title:  NA